Lineage for d3mqda1 (3mqd A:1-249)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917475Species Brucella melitensis [TaxId:359391] [225909] (5 PDB entries)
  8. 2917476Domain d3mqda1: 3mqd A:1-249 [213560]
    automated match to d1e5ma1
    complexed with 3mq, cl, na

Details for d3mqda1

PDB Entry: 3mqd (more details), 1.25 Å

PDB Description: crystal structure of beta-ketoacyl synthase from brucella melitensis with fol 0758, (1-methyl-1h-indazol-3-yl) methanol
PDB Compounds: (A:) Beta-ketoacyl synthase

SCOPe Domain Sequences for d3mqda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mqda1 c.95.1.0 (A:1-249) automated matches {Brucella melitensis [TaxId: 359391]}
mrrvvvtgmgivssigsnteevtaslreaksgisraeeyaelgfrcqvhgapdidieslv
drramrfhgrgtawnhiamdqaiadaglteeevsnertgiimgsggpstrtivdsaditr
ekgpkrvgpfavpkamsstasatlatffkikginysissacatsnhcignayemiqygkq
drmfaggcedldwtlsvlfdamgamsskyndtpstasraydknrdgfviaggagvlvled
letalarga

SCOPe Domain Coordinates for d3mqda1:

Click to download the PDB-style file with coordinates for d3mqda1.
(The format of our PDB-style files is described here.)

Timeline for d3mqda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mqda2