SCOPe 2.08: Domain d3mpzc1: 3mpz C:2-123

Lineage for d3mpzc1 (3mpz C:2-123)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.0: automated matches [191471] (1 protein)
   not a true family

6. Protein automated matches [190746] (16 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [225900] (1 PDB entry)

8. Domain d3mpzc1: 3mpz C:2-123 [213558]
   Other proteins in same PDB: d3mpza2, d3mpzb2, d3mpzc2, d3mpzd2
   automated match to d1uwza_
   complexed with zn

Details for d3mpzc1

PDB Entry: 3mpz, 1.7 Å

PDB Description: crystal structure of cytidine deaminase from mycobacterium smegmatis

PDB Compounds: (C:) Cytidine deaminase

SCOPe Domain Sequences for d3mpzc1:

Sequence; same for both SEQRES and ATOM records:

>d3mpzc1 c.97.1.0 (C:2-123) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
nwnalrskaievsrhayapysgfpvgaaalvddgrtvtgcnvenvsyglglcaecavvca
lhsggggrlvalscvgpdggvlmpcgrcrqvllehggpellidhahgprplrellpdafg
pd

Timeline for d3mpzc1:

• d3mpzc1 first appeared in SCOPe 2.03, called d3mpzc_
  
• d3mpzc1 appears in SCOPe 2.07