Lineage for d3mpwh_ (3mpw H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562704Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2562793Family d.58.56.0: automated matches [195116] (1 protein)
    not a true family
  6. 2562794Protein automated matches [195117] (12 species)
    not a true protein
  7. 2562821Species Escherichia coli K-12 [TaxId:83333] [225811] (3 PDB entries)
  8. 2562836Domain d3mpwh_: 3mpw H: [213550]
    Other proteins in same PDB: d3mpwa2, d3mpwb2, d3mpwg2
    automated match to d2a10b_
    complexed with po4

Details for d3mpwh_

PDB Entry: 3mpw (more details), 2.7 Å

PDB Description: Structure of EUTM in 2-D protein membrane
PDB Compounds: (H:) Ethanolamine utilization protein eutM

SCOPe Domain Sequences for d3mpwh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mpwh_ d.58.56.0 (H:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdagaa
aaqrigelvsvhviprphgdleevfpiglk

SCOPe Domain Coordinates for d3mpwh_:

Click to download the PDB-style file with coordinates for d3mpwh_.
(The format of our PDB-style files is described here.)

Timeline for d3mpwh_: