SCOP 1.73: Domain d1qblh2: 1qbl H:113-219

Lineage for d1qblh2 (1qbl H:113-219)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1qblh2: 1qbl H:113-219 [21355]
   Other proteins in same PDB: d1qblh1, d1qbll1, d1qbll2
   part of anti-cytochrome c Fab E8

Details for d1qblh2

PDB Entry: 1qbl, 2.26 Å

PDB Description: fab e8 (fabe8a) x-ray structure at 2.26 angstrom resolution

PDB Compounds: (H:) fabe8a

SCOP Domain Sequences for d1qblh2:

Sequence; same for both SEQRES and ATOM records:

>d1qblh2 b.1.1.2 (H:113-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
ltvssaettppsvyplapgtaalkssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
vlqsdlytltssvtvpsstwpsqtvtcnvahpasstkvdkkivprnc

Timeline for d1qblh2:

• d1qblh2 first appeared (with stable ids) in SCOP 1.55
  
• d1qblh2 appears in SCOP 1.71
  
• d1qblh2 appears in SCOP 1.75
  
• d1qblh2 appears in the current release, SCOPe 2.08