![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.56: CcmK-like [143414] (2 families) ![]() contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
![]() | Family d.58.56.0: automated matches [195116] (1 protein) not a true family |
![]() | Protein automated matches [195117] (13 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [225811] (3 PDB entries) |
![]() | Domain d3mpwc_: 3mpw C: [213545] Other proteins in same PDB: d3mpwa2, d3mpwb2, d3mpwg2 automated match to d2a10b_ complexed with po4 |
PDB Entry: 3mpw (more details), 2.7 Å
SCOPe Domain Sequences for d3mpwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mpwc_ d.58.56.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]} ealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdagaa aaqrigelvsvhviprphgdleevfpiglkg
Timeline for d3mpwc_: