Lineage for d3mpuf2 (3mpu F:101-153)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263404Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 2263405Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 2263406Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 2263407Species Escherichia coli [TaxId:562] [57828] (60 PDB entries)
    Uniprot P00478
  8. 2263486Domain d3mpuf2: 3mpu F:101-153 [213542]
    Other proteins in same PDB: d3mpua1, d3mpua2, d3mpub1, d3mpuc1, d3mpuc2, d3mpud1, d3mpue1, d3mpue2, d3mpuf1
    automated match to d1d09b2
    complexed with po4, zn

Details for d3mpuf2

PDB Entry: 3mpu (more details), 2.85 Å

PDB Description: Crystal structure of the C47A/A241C disulfide-linked E. coli Aspartate Transcarbamoylase holoenzyme
PDB Compounds: (F:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d3mpuf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mpuf2 g.41.7.1 (F:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d3mpuf2:

Click to download the PDB-style file with coordinates for d3mpuf2.
(The format of our PDB-style files is described here.)

Timeline for d3mpuf2: