Lineage for d3mpuf1 (3mpu F:11-100)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556379Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 2556380Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 2556381Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 2556382Species Escherichia coli [TaxId:562] [54896] (63 PDB entries)
    Uniprot P00478
  8. 2556432Domain d3mpuf1: 3mpu F:11-100 [213541]
    Other proteins in same PDB: d3mpua1, d3mpua2, d3mpub2, d3mpuc1, d3mpuc2, d3mpud2, d3mpue1, d3mpue2, d3mpuf2
    automated match to d1d09b1
    complexed with po4, zn

Details for d3mpuf1

PDB Entry: 3mpu (more details), 2.85 Å

PDB Description: Crystal structure of the C47A/A241C disulfide-linked E. coli Aspartate Transcarbamoylase holoenzyme
PDB Compounds: (F:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d3mpuf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mpuf1 d.58.2.1 (F:11-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
aikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsedq
vdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d3mpuf1:

Click to download the PDB-style file with coordinates for d3mpuf1.
(The format of our PDB-style files is described here.)

Timeline for d3mpuf1: