| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries) |
| Domain d1qbll2: 1qbl L:108-214 [21354] Other proteins in same PDB: d1qblh1, d1qblh2, d1qbll1 part of anti-cytochrome c Fab E8 |
PDB Entry: 1qbl (more details), 2.26 Å
SCOP Domain Sequences for d1qbll2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qbll2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1qbll2: