SCOP 1.57: Domain d1qbll2: 1qbl L:108-214

Lineage for d1qbll2 (1qbl L:108-214)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Anti-cytochrome c Fab E8, (mouse), kappa L chain [49085] (3 PDB entries)

8. Domain d1qbll2: 1qbl L:108-214 [21354]
   Other proteins in same PDB: d1qblh1, d1qbll1

Details for d1qbll2

PDB Entry: 1qbl, 2.26 Å

PDB Description: fab e8 (fabe8a) x-ray structure at 2.26 angstrom resolution

SCOP Domain Sequences for d1qbll2:

Sequence; same for both SEQRES and ATOM records:

>d1qbll2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Anti-cytochrome c Fab E8, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1qbll2:

• d1qbll2 first appeared (with stable ids) in SCOP 1.55
  
• d1qbll2 appears in SCOP 1.59
  
• d1qbll2 appears in the current release, SCOPe 2.08