Lineage for d3mpue1 (3mpu E:1-150)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513848Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2513849Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2513850Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2514290Protein automated matches [227030] (3 species)
    not a true protein
  7. 2514291Species Escherichia coli K-12 [TaxId:83333] [225926] (1 PDB entry)
  8. 2514296Domain d3mpue1: 3mpu E:1-150 [213539]
    Other proteins in same PDB: d3mpub1, d3mpub2, d3mpud1, d3mpud2, d3mpuf1, d3mpuf2
    automated match to d1ekxa1
    complexed with po4, zn

Details for d3mpue1

PDB Entry: 3mpu (more details), 2.85 Å

PDB Description: Crystal structure of the C47A/A241C disulfide-linked E. coli Aspartate Transcarbamoylase holoenzyme
PDB Compounds: (E:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d3mpue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mpue1 c.78.1.1 (E:1-150) automated matches {Escherichia coli K-12 [TaxId: 83333]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviasaffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOPe Domain Coordinates for d3mpue1:

Click to download the PDB-style file with coordinates for d3mpue1.
(The format of our PDB-style files is described here.)

Timeline for d3mpue1: