SCOPe 2.03: Domain d3mpue1: 3mpu E:1-150

Lineage for d3mpue1 (3mpu E:1-150)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein automated matches [227030] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [225926] (1 PDB entry)

8. Domain d3mpue1: 3mpu E:1-150 [213539]
   Other proteins in same PDB: d3mpub1, d3mpub2, d3mpud1, d3mpud2, d3mpuf1, d3mpuf2
   automated match to d1ekxa1
   complexed with po4, zn

Details for d3mpue1

PDB Entry: 3mpu, 2.85 Å

PDB Description: Crystal structure of the C47A/A241C disulfide-linked E. coli Aspartate Transcarbamoylase holoenzyme

PDB Compounds: (E:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d3mpue1:

Sequence; same for both SEQRES and ATOM records:

>d3mpue1 c.78.1.1 (E:1-150) automated matches {Escherichia coli [TaxId: 83333]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviasaffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d3mpue1:

• d3mpue1 is new in SCOPe 2.03-stable
  
• d3mpue1 appears in SCOPe 2.04
  
• d3mpue1 appears in the current release, SCOPe 2.08