SCOPe 2.03: Domain d3mpud1: 3mpu D:11-100

Lineage for d3mpud1 (3mpu D:11-100)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families)
   automatically mapped to Pfam PF01948

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (3 species)

7. Species Escherichia coli [TaxId:562] [54896] (59 PDB entries)
   Uniprot P00478

8. Domain d3mpud1: 3mpu D:11-100 [213537]
   Other proteins in same PDB: d3mpua1, d3mpua2, d3mpub2, d3mpuc1, d3mpuc2, d3mpud2, d3mpue1, d3mpue2, d3mpuf2
   automated match to d1d09b1
   complexed with po4, zn

Details for d3mpud1

PDB Entry: 3mpu, 2.85 Å

PDB Description: Crystal structure of the C47A/A241C disulfide-linked E. coli Aspartate Transcarbamoylase holoenzyme

PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d3mpud1:

Sequence; same for both SEQRES and ATOM records:

>d3mpud1 d.58.2.1 (D:11-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
aikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsedq
vdqlalyapqatvnridnyevvgksrpslp

Timeline for d3mpud1:

• d3mpud1 is new in SCOPe 2.03-stable
  
• d3mpud1 appears in SCOPe 2.04
  
• d3mpud1 appears in the current release, SCOPe 2.08