![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
![]() | Protein automated matches [227030] (3 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [225926] (1 PDB entry) |
![]() | Domain d3mpuc2: 3mpu C:151-310 [213536] Other proteins in same PDB: d3mpub1, d3mpub2, d3mpud1, d3mpud2, d3mpuf1, d3mpuf2 automated match to d1ekxa2 complexed with po4, zn |
PDB Entry: 3mpu (more details), 2.85 Å
SCOPe Domain Sequences for d3mpuc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mpuc2 c.78.1.1 (C:151-310) automated matches {Escherichia coli K-12 [TaxId: 83333]} rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws lhssieevmaevdilymtrvqkerldpseycnvkaqfvlrasdlhnakanmkvlhplprv deiatdvdktphawyfqqagngifarqallalvlnrdlvl
Timeline for d3mpuc2: