| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
| Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
| Protein automated matches [227030] (3 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [225926] (1 PDB entry) |
| Domain d3mpuc1: 3mpu C:1-150 [213535] Other proteins in same PDB: d3mpub1, d3mpub2, d3mpud1, d3mpud2, d3mpuf1, d3mpuf2 automated match to d1ekxa1 complexed with po4, zn |
PDB Entry: 3mpu (more details), 2.85 Å
SCOPe Domain Sequences for d3mpuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mpuc1 c.78.1.1 (C:1-150) automated matches {Escherichia coli K-12 [TaxId: 83333]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviasaffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg
Timeline for d3mpuc1: