SCOP 1.69: Domain d1wejh2: 1wej H:113-223

Lineage for d1wejh2 (1wej H:113-223)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)

8. Domain d1wejh2: 1wej H:113-223 [21353]
   Other proteins in same PDB: d1wejf_, d1wejh1, d1wejl1, d1wejl2
   part of anti-cytochrome c Fab E8

Details for d1wejh2

PDB Entry: 1wej, 1.8 Å

PDB Description: igg1 fab fragment (of e8 antibody) complexed with horse cytochrome c at 1.8 a resolution

SCOP Domain Sequences for d1wejh2:

Sequence; same for both SEQRES and ATOM records:

>d1wejh2 b.1.1.2 (H:113-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
ltvssaettppsvyplapgtaalkssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
vlqsdlytltssvtvpsstwpsqtvtcnvahpasstkvdkkivprncggdc

Timeline for d1wejh2:

• d1wejh2 first appeared (with stable ids) in SCOP 1.55
  
• d1wejh2 appears in SCOP 1.67
  
• d1wejh2 appears in SCOP 1.71
  
• d1wejh2 appears in the current release, SCOPe 2.08