Lineage for d1wejh2 (1wej H:113-223)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8482Species Anti-cytochrome c Fab E8, (mouse), kappa L chain [49085] (3 PDB entries)
  8. 8483Domain d1wejh2: 1wej H:113-223 [21353]
    Other proteins in same PDB: d1wejf_, d1wejh1, d1wejl1

Details for d1wejh2

PDB Entry: 1wej (more details), 1.8 Å

PDB Description: igg1 fab fragment (of e8 antibody) complexed with horse cytochrome c at 1.8 a resolution
PDB Compounds: (H:)

SCOP Domain Sequences for d1wejh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wejh2 b.1.1.2 (H:113-223) Immunoglobulin (constant domains of L and H chains) {Anti-cytochrome c Fab E8, (mouse), kappa L chain}
ltvssaettppsvyplapgtaalkssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
vlqsdlytltssvtvpsstwpsqtvtcnvahpasstkvdkkivprncggdc

SCOP Domain Coordinates for d1wejh2:

Click to download the PDB-style file with coordinates for d1wejh2.
(The format of our PDB-style files is described here.)

Timeline for d1wejh2: