SCOPe 2.03: Domain d3mpjf2: 3mpj F:232-390

Lineage for d3mpjf2 (3mpj F:232-390)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (15 species)
   not a true protein

7. Species Desulfococcus multivorans [TaxId:897] [225944] (2 PDB entries)

8. Domain d3mpjf2: 3mpj F:232-390 [213528]
   Other proteins in same PDB: d3mpja1, d3mpjb1, d3mpjd1, d3mpje1, d3mpjf1, d3mpjg1
   automated match to d3mdea1
   complexed with cl, fad

Details for d3mpjf2

PDB Entry: 3mpj, 2.1 Å

PDB Description: Structure of the glutaryl-coenzyme A dehydrogenase

PDB Compounds: (F:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3mpjf2:

Sequence; same for both SEQRES and ATOM records:

>d3mpjf2 a.29.3.0 (F:232-390) automated matches {Desulfococcus multivorans [TaxId: 897]}
gdgarivfgslnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqm
aveveaarllaykaaaakdegrlnngldvamakyaageavskcanyamrilgaygystey
pvarfyrdaptyymvegsanickmiialdqlgvrkanrk

Timeline for d3mpjf2:

• d3mpjf2 is new in SCOPe 2.03-stable
  
• d3mpjf2 appears in SCOPe 2.04
  
• d3mpjf2 appears in the current release, SCOPe 2.08