| Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
| Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
| Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
| Protein automated matches [226934] (29 species) not a true protein |
| Species Desulfococcus multivorans [TaxId:897] [225943] (2 PDB entries) |
| Domain d3mpib1: 3mpi B:1-231 [213513] Other proteins in same PDB: d3mpia2, d3mpia3, d3mpib2, d3mpib3, d3mpic2, d3mpic3, d3mpid2, d3mpid3 automated match to d3mdea2 complexed with fad, gra |
PDB Entry: 3mpi (more details), 2.05 Å
SCOPe Domain Sequences for d3mpib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mpib1 e.6.1.0 (B:1-231) automated matches {Desulfococcus multivorans [TaxId: 897]}
mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkp
Timeline for d3mpib1: