Lineage for d3mofb1 (3mof B:-1-259)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1884249Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 1884250Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 1884251Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 1884252Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)
  7. 1884262Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (29 PDB entries)
  8. 1884279Domain d3mofb1: 3mof B:-1-259 [213505]
    Other proteins in same PDB: d3mofa2, d3mofb2
    automated match to d1khba2
    complexed with 1pe, edo, gtp, mn, na, oxl; mutant

Details for d3mofb1

PDB Entry: 3mof (more details), 1.75 Å

PDB Description: the structure of rat cytosolic pepck mutant a467g in complex with oxalate and gtp
PDB Compounds: (B:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d3mofb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mofb1 c.109.1.1 (B:-1-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gsmppqlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrlla
hmqeegvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwms
eedfekafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgt
svlealgdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggn
sllgkkcfalriasrlakeeg

SCOPe Domain Coordinates for d3mofb1:

Click to download the PDB-style file with coordinates for d3mofb1.
(The format of our PDB-style files is described here.)

Timeline for d3mofb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mofb2