SCOPe 2.08: Domain d3mofa1: 3mof A:1-259

Lineage for d3mofa1 (3mof A:1-259)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)

6. Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (42 PDB entries)

8. Domain d3mofa1: 3mof A:1-259 [213503]
   Other proteins in same PDB: d3mofa2, d3mofa3, d3mofb2, d3mofb3
   automated match to d1khba2
   complexed with 1pe, edo, gtp, mn, na, oxl; mutant

Details for d3mofa1

PDB Entry: 3mof, 1.75 Å

PDB Description: the structure of rat cytosolic pepck mutant a467g in complex with oxalate and gtp

PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d3mofa1:

Sequence; same for both SEQRES and ATOM records:

>d3mofa1 c.109.1.1 (A:1-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mppqlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahm
qeegvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmsee
dfekafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsv
lealgdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsl
lgkkcfalriasrlakeeg

Timeline for d3mofa1:

• d3mofa1 first appeared in SCOPe 2.03
  
• d3mofa1 appears in SCOPe 2.07