Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Mus musculus, homo [TaxId:10090] [226013] (2 PDB entries) |
Domain d3mo1a1: 3mo1 A:0-107 [213493] automated match to d1dqdl1 complexed with act, so4 |
PDB Entry: 3mo1 (more details), 1.8 Å
SCOPe Domain Sequences for d3mo1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mo1a1 b.1.1.0 (A:0-107) automated matches {Mus musculus, homo [TaxId: 10090]} ldiqltqspsslamsggqkvtmrckssqsllnsrnernylawyqqkpgqspkllvyfasi resgvpdrfigsgsgtdftltissvqaedladyfclqhyntpwtfgggtkleik
Timeline for d3mo1a1: