![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries) |
![]() | Domain d2mpah2: 2mpa H:122-224 [21349] Other proteins in same PDB: d2mpah1, d2mpal1, d2mpal2 part of bactericidal Fab MN12H2 against Neisseria meningitidis complexed with cd, cyf, thc |
PDB Entry: 2mpa (more details), 2.6 Å
SCOP Domain Sequences for d2mpah2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mpah2 b.1.1.2 (H:122-224) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt
Timeline for d2mpah2: