Lineage for d3mn7a2 (3mn7 A:147-375)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2137195Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2137589Protein automated matches [226905] (13 species)
    not a true protein
  7. 2137611Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225128] (13 PDB entries)
  8. 2137627Domain d3mn7a2: 3mn7 A:147-375 [213486]
    automated match to d1d4xa2
    complexed with atp, ca

Details for d3mn7a2

PDB Entry: 3mn7 (more details), 2 Å

PDB Description: structures of actin-bound wh2 domains of spire and the implication for filament nucleation
PDB Compounds: (A:) Actin-5C

SCOPe Domain Sequences for d3mn7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mn7a2 c.55.1.1 (A:147-375) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rttgivldsgdgvshtvpiyegyalphailrldlagrdltdylmkiltergysfttteer
eivrdikeklcyvaldfeqemataassssleksyelkdgqvitignerfrcpealfqpsf
lgmeacgihettynsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkcf

SCOPe Domain Coordinates for d3mn7a2:

Click to download the PDB-style file with coordinates for d3mn7a2.
(The format of our PDB-style files is described here.)

Timeline for d3mn7a2: