SCOPe 2.03: Domain d3mn7a2: 3mn7 A:147-375

Lineage for d3mn7a2 (3mn7 A:147-375)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (10 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225128] (11 PDB entries)

8. Domain d3mn7a2: 3mn7 A:147-375 [213486]
   automated match to d1d4xa2
   complexed with atp, ca

Details for d3mn7a2

PDB Entry: 3mn7, 2 Å

PDB Description: structures of actin-bound wh2 domains of spire and the implication for filament nucleation

PDB Compounds: (A:) Actin-5C

SCOPe Domain Sequences for d3mn7a2:

Sequence; same for both SEQRES and ATOM records:

>d3mn7a2 c.55.1.1 (A:147-375) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rttgivldsgdgvshtvpiyegyalphailrldlagrdltdylmkiltergysfttteer
eivrdikeklcyvaldfeqemataassssleksyelkdgqvitignerfrcpealfqpsf
lgmeacgihettynsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkcf

Timeline for d3mn7a2:

• d3mn7a2 is new in SCOPe 2.03-stable
  
• d3mn7a2 appears in SCOPe 2.04
  
• d3mn7a2 appears in the current release, SCOPe 2.08