Lineage for d3mn7a1 (3mn7 A:5-146)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883861Protein automated matches [226905] (13 species)
    not a true protein
  7. 2883908Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225128] (13 PDB entries)
  8. 2883921Domain d3mn7a1: 3mn7 A:5-146 [213485]
    automated match to d1d4xa1
    complexed with atp, ca

Details for d3mn7a1

PDB Entry: 3mn7 (more details), 2 Å

PDB Description: structures of actin-bound wh2 domains of spire and the implication for filament nucleation
PDB Compounds: (A:) Actin-5C

SCOPe Domain Sequences for d3mn7a1:

Sequence, based on SEQRES records: (download)

>d3mn7a1 c.55.1.1 (A:5-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimf
etfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d3mn7a1 c.55.1.1 (A:5-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vaalvvdngsgmckagfagddapravfpsivgrpdsyvgdeaqskrgiltlkypiehgiv
tnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpamyvai
qavlslyasg

SCOPe Domain Coordinates for d3mn7a1:

Click to download the PDB-style file with coordinates for d3mn7a1.
(The format of our PDB-style files is described here.)

Timeline for d3mn7a1: