| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
| Protein automated matches [226905] (13 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225128] (13 PDB entries) |
| Domain d3mn6k1: 3mn6 K:5-146 [213483] automated match to d1d4xa1 complexed with atp, ca |
PDB Entry: 3mn6 (more details), 2 Å
SCOPe Domain Sequences for d3mn6k1:
Sequence, based on SEQRES records: (download)
>d3mn6k1 c.55.1.1 (K:5-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimf
etfntpamyvaiqavlslyasg
>d3mn6k1 c.55.1.1 (K:5-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vaalvvdngsgmckagfagddapravfpsivgrprdsyvgdeaqskrgiltlkypiehgi
vtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpamyva
iqavlslyasg
Timeline for d3mn6k1:
View in 3DDomains from other chains: (mouse over for more information) d3mn6a1, d3mn6a2, d3mn6f1, d3mn6f2 |