Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein automated matches [226905] (13 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225128] (13 PDB entries) |
Domain d3mn6a2: 3mn6 A:147-375 [213480] automated match to d1d4xa2 complexed with atp, ca |
PDB Entry: 3mn6 (more details), 2 Å
SCOPe Domain Sequences for d3mn6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mn6a2 c.55.1.1 (A:147-375) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} rttgivldsgdgvshtvpiyegyalphailrldlagrdltdylmkiltergysfttteer eivrdikeklcyvaldfeqemataassssleksyelkdgqvitignerfrcpealfqpsf lgmeacgihettynsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkcf
Timeline for d3mn6a2:
View in 3D Domains from other chains: (mouse over for more information) d3mn6f1, d3mn6f2, d3mn6k1, d3mn6k2 |