![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (35 species) not a true protein |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225907] (4 PDB entries) |
![]() | Domain d3mn5a1: 3mn5 A:5-146 [213477] Other proteins in same PDB: d3mn5a2 automated match to d1d4xa1 complexed with atp, ca, lab |
PDB Entry: 3mn5 (more details), 1.5 Å
SCOPe Domain Sequences for d3mn5a1:
Sequence, based on SEQRES records: (download)
>d3mn5a1 c.55.1.0 (A:5-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ttalvcdngsglvkagfagddapravfpsivgrvgdeaqskrgiltlkypiehgiitnwd dmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyvaiqavl slyasg
>d3mn5a1 c.55.1.0 (A:5-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ttalvcdngsglvkagfagddapravfpsivgrvgdertlkypiehgiitnwddmekiwh htfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyvaiqavlslyasg
Timeline for d3mn5a1: