Lineage for d3mn1k_ (3mn1 K:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883848Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1883849Protein automated matches [190447] (49 species)
    not a true protein
  7. 1884153Species Pseudomonas syringae [TaxId:264730] [196431] (2 PDB entries)
  8. 1884164Domain d3mn1k_: 3mn1 K: [213474]
    automated match to d3nrjl_
    complexed with cl

Details for d3mn1k_

PDB Entry: 3mn1 (more details), 1.8 Å

PDB Description: crystal structure of probable yrbi family phosphatase from pseudomonas syringae pv.phaseolica 1448a
PDB Compounds: (K:) probable yrbi family phosphatase

SCOPe Domain Sequences for d3mn1k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mn1k_ c.108.1.0 (K:) automated matches {Pseudomonas syringae [TaxId: 264730]}
sqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmliasgvttaii
sgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlpdlpvirr
vglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvylegh

SCOPe Domain Coordinates for d3mn1k_:

Click to download the PDB-style file with coordinates for d3mn1k_.
(The format of our PDB-style files is described here.)

Timeline for d3mn1k_: