Lineage for d3mn1g1 (3mn1 G:8-179)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920596Species Pseudomonas syringae [TaxId:264730] [196431] (2 PDB entries)
  8. 2920603Domain d3mn1g1: 3mn1 G:8-179 [213470]
    Other proteins in same PDB: d3mn1a2, d3mn1a3, d3mn1b2, d3mn1c2, d3mn1d2, d3mn1e2, d3mn1f2, d3mn1g2, d3mn1h2, d3mn1i2, d3mn1j2, d3mn1k2, d3mn1l2
    automated match to d3nrjl_
    complexed with cl

Details for d3mn1g1

PDB Entry: 3mn1 (more details), 1.8 Å

PDB Description: crystal structure of probable yrbi family phosphatase from pseudomonas syringae pv.phaseolica 1448a
PDB Compounds: (G:) probable yrbi family phosphatase

SCOPe Domain Sequences for d3mn1g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mn1g1 c.108.1.0 (G:8-179) automated matches {Pseudomonas syringae [TaxId: 264730]}
qdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmliasgvttaiis
grktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlpdlpvirrv
glgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvyl

SCOPe Domain Coordinates for d3mn1g1:

Click to download the PDB-style file with coordinates for d3mn1g1.
(The format of our PDB-style files is described here.)

Timeline for d3mn1g1: