![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (55 species) not a true protein |
![]() | Species Pseudomonas syringae [TaxId:264730] [196431] (2 PDB entries) |
![]() | Domain d3mn1d1: 3mn1 D:7-179 [213467] Other proteins in same PDB: d3mn1a2, d3mn1a3, d3mn1b2, d3mn1c2, d3mn1d2, d3mn1e2, d3mn1f2, d3mn1g2, d3mn1h2, d3mn1i2, d3mn1j2, d3mn1k2, d3mn1l2 automated match to d3nrjl_ complexed with cl |
PDB Entry: 3mn1 (more details), 1.8 Å
SCOPe Domain Sequences for d3mn1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mn1d1 c.108.1.0 (D:7-179) automated matches {Pseudomonas syringae [TaxId: 264730]} sqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmliasgvttaii sgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlpdlpvirr vglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvyl
Timeline for d3mn1d1: