SCOP 1.63: Domain d2f58l2: 2f58 L:108-212

Lineage for d2f58l2 (2f58 L:108-212)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain [49083] (3 PDB entries)

8. Domain d2f58l2: 2f58 L:108-212 [21346]
   Other proteins in same PDB: d2f58h1, d2f58l1

Details for d2f58l2

PDB Entry: 2f58, 2.8 Å

PDB Description: igg1 fab fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of hiv-1 gp120) (mn isolate)

SCOP Domain Sequences for d2f58l2:

Sequence; same for both SEQRES and ATOM records:

>d2f58l2 b.1.1.2 (L:108-212) Immunoglobulin (constant domains of L and H chains) {Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

Timeline for d2f58l2:

• d2f58l2 first appeared (with stable ids) in SCOP 1.55
  
• d2f58l2 appears in SCOP 1.61
  
• d2f58l2 appears in SCOP 1.65
  
• d2f58l2 appears in the current release, SCOPe 2.08