Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein automated matches [226905] (13 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225128] (13 PDB entries) |
Domain d3mmva1: 3mmv A:5-146 [213458] automated match to d1d4xa1 complexed with atp, ca |
PDB Entry: 3mmv (more details), 2.8 Å
SCOPe Domain Sequences for d3mmva1:
Sequence, based on SEQRES records: (download)
>d3mmva1 c.55.1.1 (A:5-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} vaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi ltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimf etfntpamyvaiqavlslyasg
>d3mmva1 c.55.1.1 (A:5-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} vaalvvdngsgmckagfagddapravfpsivgrprdsyvgdeaqskrgiltlkypiehgi vtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpamyva iqavlslyasg
Timeline for d3mmva1: