Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (46 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [186796] (4 PDB entries) |
Domain d3mmud_: 3mmu D: [213453] automated match to d1ceca_ complexed with cd, ni |
PDB Entry: 3mmu (more details), 2.2 Å
SCOPe Domain Sequences for d3mmud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mmud_ c.1.8.0 (D:) automated matches {Thermotoga maritima [TaxId: 2336]} vdpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwsthaya fppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiadry kdypetlffeilnephgnltpekwnelleealkvirsidkkhtiiigtaewggisalekl svpkweknsivtihyynpfefthqgaewvegsekwlgrkwgspddqkhlieefnfieews kknkrpiyigefgayrkadlesrikwtsfvvremekrrwswaywefcsgfgvydtlrktw nkdlleali
Timeline for d3mmud_: