SCOP 1.67: Domain d3f58h2: 3f58 H:114-230

Lineage for d3f58h2 (3f58 H:114-230)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)

8. Domain d3f58h2: 3f58 H:114-230 [21345]
   Other proteins in same PDB: d3f58h1, d3f58l1, d3f58l2
   part of anti-gp120 (HIV-1) Fab 58.2
   mutant

Details for d3f58h2

PDB Entry: 3f58, 2.8 Å

PDB Description: igg1 fab fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of hiv-1 gp120 (mn isolate); h315s mutation

SCOP Domain Sequences for d3f58h2:

Sequence; same for both SEQRES and ATOM records:

>d3f58h2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

Timeline for d3f58h2:

• d3f58h2 first appeared (with stable ids) in SCOP 1.55
  
• d3f58h2 appears in SCOP 1.65
  
• d3f58h2 appears in SCOP 1.69
  
• d3f58h2 appears in the current release, SCOPe 2.08