Lineage for d3mmbe2 (3mmb E:123-196,E:262-366)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1927715Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 1927716Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) (S)
    duplication: contains two domains of this fold
  5. 1927717Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins)
  6. 1927739Protein Dissimilatory sulfite reductase subunit beta, DsrB [160772] (2 species)
  7. 1927740Species Archaeoglobus fulgidus [TaxId:2234] [160774] (8 PDB entries)
    Uniprot Q59110 123-196,262-366
  8. 1927756Domain d3mmbe2: 3mmb E:123-196,E:262-366 [213448]
    Other proteins in same PDB: d3mmba1, d3mmba2, d3mmba3, d3mmbb1, d3mmbb3, d3mmbd1, d3mmbd2, d3mmbd3, d3mmbe1, d3mmbe3
    automated match to d3mmcb3
    complexed with h2s, sf4, srm

Details for d3mmbe2

PDB Entry: 3mmb (more details), 2.3 Å

PDB Description: dissimilatory sulfite reductase in complex with the endproduct sulfide
PDB Compounds: (E:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3mmbe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmbe2 d.134.1.1 (E:123-196,E:262-366) Dissimilatory sulfite reductase subunit beta, DsrB {Archaeoglobus fulgidus [TaxId: 2234]}
kgeyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccanmc
gavhasdiaivgihXdgaaimvggklsearrmpelskvvvpwvpnepprwptlvkyvkqi
leawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefrastqfkw

SCOPe Domain Coordinates for d3mmbe2:

Click to download the PDB-style file with coordinates for d3mmbe2.
(The format of our PDB-style files is described here.)

Timeline for d3mmbe2: