| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
| Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
| Protein DsrB insert domain [160277] (2 species) |
| Species Archaeoglobus fulgidus [TaxId:2234] [160279] (9 PDB entries) Uniprot Q59110 197-261 |
| Domain d3mmbb3: 3mmb B:197-261 [213443] Other proteins in same PDB: d3mmba1, d3mmba2, d3mmba3, d3mmbb1, d3mmbb2, d3mmbd1, d3mmbd2, d3mmbd3, d3mmbe1, d3mmbe2 automated match to d3mmcb1 complexed with h2s, sf4, srm |
PDB Entry: 3mmb (more details), 2.3 Å
SCOPe Domain Sequences for d3mmbb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mmbb3 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
rtppipndeairktceipstvaacptgalkpdmknktikvdvekcmycgncytmcpgmpl
fdpen
Timeline for d3mmbb3: