SCOP 1.73: Domain d3f58l2: 3f58 L:108-211

Lineage for d3f58l2 (3f58 L:108-211)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d3f58l2: 3f58 L:108-211 [21344]
   Other proteins in same PDB: d3f58h1, d3f58h2, d3f58l1
   part of anti-gp120 (HIV-1) Fab 58.2
   mutant

Details for d3f58l2

PDB Entry: 3f58, 2.8 Å

PDB Description: igg1 fab fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of hiv-1 gp120 (mn isolate); h315s mutation

PDB Compounds: (L:) protein (immunoglobulin gamma I (58.2))

SCOP Domain Sequences for d3f58l2:

Sequence; same for both SEQRES and ATOM records:

>d3f58l2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d3f58l2:

• d3f58l2 first appeared (with stable ids) in SCOP 1.55
  
• d3f58l2 appears in SCOP 1.71
  
• d3f58l2 appears in SCOP 1.75
  
• d3f58l2 appears in the current release, SCOPe 2.08