Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein DsrB insert domain [160277] (2 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [160279] (9 PDB entries) Uniprot Q59110 197-261 |
Domain d3mmae3: 3mma E:197-261 [213437] Other proteins in same PDB: d3mmaa1, d3mmaa2, d3mmaa3, d3mmab1, d3mmab2, d3mmad1, d3mmad2, d3mmad3, d3mmae1, d3mmae2 automated match to d3mmcb1 complexed with po4, sf4, srm |
PDB Entry: 3mma (more details), 2.3 Å
SCOPe Domain Sequences for d3mmae3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mmae3 d.58.1.5 (E:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} rtppipndeairktceipstvaacptgalkpdmknktikvdvekcmycgncytmcpgmpl fdpen
Timeline for d3mmae3: