| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
| Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
| Protein DsrA insert domain [160280] (2 species) |
| Species Archaeoglobus fulgidus [TaxId:2234] [160282] (8 PDB entries) Uniprot Q59109 240-305 |
| Domain d3mmaa3: 3mma A:239-304 [213428] Other proteins in same PDB: d3mmaa1, d3mmaa2, d3mmab1, d3mmab2, d3mmab3, d3mmad1, d3mmad2, d3mmae1, d3mmae2, d3mmae3 automated match to d3mmca1 complexed with po4, sf4, srm |
PDB Entry: 3mma (more details), 2.3 Å
SCOPe Domain Sequences for d3mmaa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mmaa3 d.58.1.5 (A:239-304) DsrA insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
kddikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpka
lkpgde
Timeline for d3mmaa3: