Lineage for d3mm9b3 (3mm9 B:197-261)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949232Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 2949306Protein DsrB insert domain [160277] (2 species)
  7. 2949307Species Archaeoglobus fulgidus [TaxId:2234] [160279] (9 PDB entries)
    Uniprot Q59110 197-261
  8. 2949318Domain d3mm9b3: 3mm9 B:197-261 [213419]
    Other proteins in same PDB: d3mm9a1, d3mm9a2, d3mm9a3, d3mm9b1, d3mm9b2, d3mm9d1, d3mm9d2, d3mm9d3, d3mm9e1, d3mm9e2
    automated match to d3mmcb1
    complexed with no2, sf4, srm

Details for d3mm9b3

PDB Entry: 3mm9 (more details), 2.1 Å

PDB Description: dissimilatory sulfite reductase nitrite complex
PDB Compounds: (B:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3mm9b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mm9b3 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
rtppipndeairktceipstvaacptgalkpdmknktikvdvekcmycgncytmcpgmpl
fdpen

SCOPe Domain Coordinates for d3mm9b3:

Click to download the PDB-style file with coordinates for d3mm9b3.
(The format of our PDB-style files is described here.)

Timeline for d3mm9b3: