| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily) beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2 |
Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) ![]() duplication: contains two domains of this fold |
| Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins) |
| Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160777] (2 species) |
| Species Archaeoglobus fulgidus [TaxId:2234] [160779] (8 PDB entries) Uniprot Q59109 168-239,306-418 |
| Domain d3mm9a2: 3mm9 A:167-238,A:305-417 [213415] Other proteins in same PDB: d3mm9a1, d3mm9a3, d3mm9b1, d3mm9b2, d3mm9b3, d3mm9d1, d3mm9d3, d3mm9e1, d3mm9e2, d3mm9e3 automated match to d3mmca3 complexed with no2, sf4, srm |
PDB Entry: 3mm9 (more details), 2.1 Å
SCOPe Domain Sequences for d3mm9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mm9a2 d.134.1.1 (A:167-238,A:305-417) Dissimilatory sulfite reductase subunit alpha, DsrA {Archaeoglobus fulgidus [TaxId: 2234]}
sdlrtpsacmgpalcefacydtlelcydltmtyqdelhrpmwpykfkikcagcpndcvas
karsdfaiigtwXrgatiliggkapfvegavigwvavpfvevekpydeikeileaiwdww
deegkfrerigeliwrkgmreflkvigreadvrmvkaprnnpfmffekdelkpsayteel
kkrgmw
Timeline for d3mm9a2: