| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
| Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
| Protein DsrB insert domain [160277] (2 species) |
| Species Archaeoglobus fulgidus [TaxId:2234] [160279] (9 PDB entries) Uniprot Q59110 197-261 |
| Domain d3mm8e3: 3mm8 E:197-261 [213413] Other proteins in same PDB: d3mm8a1, d3mm8a2, d3mm8a3, d3mm8b1, d3mm8b2, d3mm8d1, d3mm8d2, d3mm8d3, d3mm8e1, d3mm8e2 automated match to d3mmcb1 complexed with no3, sf4, srm |
PDB Entry: 3mm8 (more details), 2.28 Å
SCOPe Domain Sequences for d3mm8e3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mm8e3 d.58.1.5 (E:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
rtppipndeairktceipstvaacptgalkpdmknktikvdvekcmycgncytmcpgmpl
fdpen
Timeline for d3mm8e3: