SCOPe 2.03: Domain d3mm8e2: 3mm8 E:123-196,E:262-366

Lineage for d3mm8e2 (3mm8 E:123-196,E:262-366)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
   beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2

4. Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (1 family)
   duplication: contains two domains of this fold

5. Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins)

6. Protein Dissimilatory sulfite reductase subunit beta, DsrB [160772] (2 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [160774] (8 PDB entries)
   Uniprot Q59110 123-196,262-366

8. Domain d3mm8e2: 3mm8 E:123-196,E:262-366 [213412]
   Other proteins in same PDB: d3mm8a1, d3mm8a2, d3mm8a3, d3mm8b1, d3mm8b3, d3mm8d1, d3mm8d2, d3mm8d3, d3mm8e1, d3mm8e3
   automated match to d3mmcb3
   complexed with no3, sf4, srm

Details for d3mm8e2

PDB Entry: 3mm8, 2.28 Å

PDB Description: dissimilatory sulfite reductase nitrate complex

PDB Compounds: (E:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3mm8e2:

Sequence; same for both SEQRES and ATOM records:

>d3mm8e2 d.134.1.1 (E:123-196,E:262-366) Dissimilatory sulfite reductase subunit beta, DsrB {Archaeoglobus fulgidus [TaxId: 2234]}
kgeyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccanmc
gavhasdiaivgihXdgaaimvggklsearrmpelskvvvpwvpnepprwptlvkyvkqi
leawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefrastqfkw

Timeline for d3mm8e2:

• d3mm8e2 is new in SCOPe 2.03-stable
  
• d3mm8e2 appears in SCOPe 2.04
  
• d3mm8e2 appears in the current release, SCOPe 2.08