Lineage for d3mm8e2 (3mm8 E:123-196,E:262-366)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432337Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 1432338Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (1 family) (S)
    duplication: contains two domains of this fold
  5. 1432339Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins)
  6. 1432361Protein Dissimilatory sulfite reductase subunit beta, DsrB [160772] (2 species)
  7. 1432362Species Archaeoglobus fulgidus [TaxId:2234] [160774] (8 PDB entries)
    Uniprot Q59110 123-196,262-366
  8. 1432376Domain d3mm8e2: 3mm8 E:123-196,E:262-366 [213412]
    Other proteins in same PDB: d3mm8a1, d3mm8a2, d3mm8a3, d3mm8b1, d3mm8b3, d3mm8d1, d3mm8d2, d3mm8d3, d3mm8e1, d3mm8e3
    automated match to d3mmcb3
    complexed with no3, sf4, srm

Details for d3mm8e2

PDB Entry: 3mm8 (more details), 2.28 Å

PDB Description: dissimilatory sulfite reductase nitrate complex
PDB Compounds: (E:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3mm8e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mm8e2 d.134.1.1 (E:123-196,E:262-366) Dissimilatory sulfite reductase subunit beta, DsrB {Archaeoglobus fulgidus [TaxId: 2234]}
kgeyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccanmc
gavhasdiaivgihXdgaaimvggklsearrmpelskvvvpwvpnepprwptlvkyvkqi
leawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefrastqfkw

SCOPe Domain Coordinates for d3mm8e2:

Click to download the PDB-style file with coordinates for d3mm8e2.
(The format of our PDB-style files is described here.)

Timeline for d3mm8e2: