Lineage for d3mm8a1 (3mm8 A:1-166)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955424Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955470Family d.58.36.2: DsrA/DsrB N-terminal-domain-like [160336] (2 proteins)
    Dissimilatory sulfite reductase is a heterodimer of homologous DsrA and DsrB subunits, the assembly of which is similar to the architecture of duplicated sulfite reductase CysI
  6. 2955471Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160337] (2 species)
  7. 2955472Species Archaeoglobus fulgidus [TaxId:2234] [160338] (8 PDB entries)
    Uniprot Q59109 2-418
  8. 2955483Domain d3mm8a1: 3mm8 A:1-166 [213402]
    Other proteins in same PDB: d3mm8a2, d3mm8a3, d3mm8b1, d3mm8b2, d3mm8b3, d3mm8d2, d3mm8d3, d3mm8e1, d3mm8e2, d3mm8e3
    automated match to d3mmca2
    complexed with no3, sf4, srm

Details for d3mm8a1

PDB Entry: 3mm8 (more details), 2.28 Å

PDB Description: dissimilatory sulfite reductase nitrate complex
PDB Compounds: (A:) sulfite reductase, dissimilatory-type subunit alpha

SCOPe Domain Sequences for d3mm8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mm8a1 d.58.36.2 (A:1-166) Dissimilatory sulfite reductase subunit alpha, DsrA {Archaeoglobus fulgidus [TaxId: 2234]}
setplldelekgpwpsfvkeikktaelmekaaaegkdvkmpkgargllkqleisykdkkt
hwkhggivsvvgygggvigrysdlgeqipevehfhtmrinqpsgwfystkalrglcdvwe
kwgsgltnfhgstgdiiflgtrseylqpcfedlgnleipfdiggsg

SCOPe Domain Coordinates for d3mm8a1:

Click to download the PDB-style file with coordinates for d3mm8a1.
(The format of our PDB-style files is described here.)

Timeline for d3mm8a1: