Lineage for d3mm7e1 (3mm7 E:4-122)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2198234Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 2198276Family d.58.36.2: DsrA/DsrB N-terminal-domain-like [160336] (2 proteins)
    Dissimilatory sulfite reductase is a heterodimer of homologous DsrA and DsrB subunits, the assembly of which is similar to the architecture of duplicated sulfite reductase CysI
  6. 2198298Protein Dissimilatory sulfite reductase subunit beta, DsrB [160340] (2 species)
  7. 2198299Species Archaeoglobus fulgidus [TaxId:2234] [160341] (9 PDB entries)
    Uniprot Q59110 4-122
  8. 2198305Domain d3mm7e1: 3mm7 E:4-122 [213399]
    Other proteins in same PDB: d3mm7a1, d3mm7a2, d3mm7a3, d3mm7b2, d3mm7b3, d3mm7d1, d3mm7d2, d3mm7d3, d3mm7e2, d3mm7e3
    automated match to d3mmcb2
    complexed with cmo, sf4, srm

Details for d3mm7e1

PDB Entry: 3mm7 (more details), 1.9 Å

PDB Description: dissimilatory sulfite reductase carbon monoxide complex
PDB Compounds: (E:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3mm7e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mm7e1 d.58.36.2 (E:4-122) Dissimilatory sulfite reductase subunit beta, DsrB {Archaeoglobus fulgidus [TaxId: 2234]}
egvktdfgppyfrdllhpviaknygkwkyhevvkpgvikrvaesgdviyvvrfgtprlls
iytvrelcdiadkysdgylrwtsrnnveffvtdeskiddlinevqervgfpcggtwdav

SCOPe Domain Coordinates for d3mm7e1:

Click to download the PDB-style file with coordinates for d3mm7e1.
(The format of our PDB-style files is described here.)

Timeline for d3mm7e1: