Lineage for d3mm7d3 (3mm7 D:239-304)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1413689Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1413821Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1413858Protein DsrA insert domain [160280] (2 species)
  7. 1413859Species Archaeoglobus fulgidus [TaxId:2234] [160282] (8 PDB entries)
    Uniprot Q59109 240-305
  8. 1413865Domain d3mm7d3: 3mm7 D:239-304 [213398]
    Other proteins in same PDB: d3mm7a1, d3mm7a2, d3mm7b1, d3mm7b2, d3mm7b3, d3mm7d1, d3mm7d2, d3mm7e1, d3mm7e2, d3mm7e3
    automated match to d3mmca1
    complexed with cmo, sf4, srm

Details for d3mm7d3

PDB Entry: 3mm7 (more details), 1.9 Å

PDB Description: dissimilatory sulfite reductase carbon monoxide complex
PDB Compounds: (D:) sulfite reductase, dissimilatory-type subunit alpha

SCOPe Domain Sequences for d3mm7d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mm7d3 d.58.1.5 (D:239-304) DsrA insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
kddikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpka
lkpgde

SCOPe Domain Coordinates for d3mm7d3:

Click to download the PDB-style file with coordinates for d3mm7d3.
(The format of our PDB-style files is described here.)

Timeline for d3mm7d3: