![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily) beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2 |
![]() | Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) ![]() duplication: contains two domains of this fold |
![]() | Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins) |
![]() | Protein Dissimilatory sulfite reductase subunit beta, DsrB [160772] (2 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [160774] (9 PDB entries) Uniprot Q59110 123-196,262-366 |
![]() | Domain d3mm7b2: 3mm7 B:123-196,B:262-366 [213394] Other proteins in same PDB: d3mm7a1, d3mm7a2, d3mm7a3, d3mm7b1, d3mm7b3, d3mm7d1, d3mm7d2, d3mm7d3, d3mm7e1, d3mm7e3 automated match to d3mmcb3 complexed with cmo, sf4, srm |
PDB Entry: 3mm7 (more details), 1.9 Å
SCOPe Domain Sequences for d3mm7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mm7b2 d.134.1.1 (B:123-196,B:262-366) Dissimilatory sulfite reductase subunit beta, DsrB {Archaeoglobus fulgidus [TaxId: 2234]} kgeyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccanmc gavhasdiaivgihXdgaaimvggklsearrmpelskvvvpwvpnepprwptlvkyvkqi leawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefrastqfkw
Timeline for d3mm7b2: