Lineage for d3mm7a2 (3mm7 A:167-238,A:305-417)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2977656Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 2977657Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) (S)
    duplication: contains two domains of this fold
  5. 2977658Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins)
  6. 2977659Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160777] (2 species)
  7. 2977660Species Archaeoglobus fulgidus [TaxId:2234] [160779] (8 PDB entries)
    Uniprot Q59109 168-239,306-418
  8. 2977667Domain d3mm7a2: 3mm7 A:167-238,A:305-417 [213391]
    Other proteins in same PDB: d3mm7a1, d3mm7a3, d3mm7b1, d3mm7b2, d3mm7b3, d3mm7d1, d3mm7d3, d3mm7e1, d3mm7e2, d3mm7e3
    automated match to d3mmca3
    complexed with cmo, sf4, srm

Details for d3mm7a2

PDB Entry: 3mm7 (more details), 1.9 Å

PDB Description: dissimilatory sulfite reductase carbon monoxide complex
PDB Compounds: (A:) sulfite reductase, dissimilatory-type subunit alpha

SCOPe Domain Sequences for d3mm7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mm7a2 d.134.1.1 (A:167-238,A:305-417) Dissimilatory sulfite reductase subunit alpha, DsrA {Archaeoglobus fulgidus [TaxId: 2234]}
sdlrtpsacmgpalcefacydtlelcydltmtyqdelhrpmwpykfkikcagcpndcvas
karsdfaiigtwXrgatiliggkapfvegavigwvavpfvevekpydeikeileaiwdww
deegkfrerigeliwrkgmreflkvigreadvrmvkaprnnpfmffekdelkpsayteel
kkrgmw

SCOPe Domain Coordinates for d3mm7a2:

Click to download the PDB-style file with coordinates for d3mm7a2.
(The format of our PDB-style files is described here.)

Timeline for d3mm7a2: