Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [49082] (8 PDB entries) |
Domain d1hh9b2: 1hh9 B:113-213 [21339] Other proteins in same PDB: d1hh9a1, d1hh9b1 |
PDB Entry: 1hh9 (more details), 2.7 Å
SCOP Domain Sequences for d1hh9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hh9b2 b.1.1.2 (B:113-213) Immunoglobulin (constant domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain} akttapsvyplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsg lytlsssvtvtsntwpsqtitcnvahpasstkvdkkieprv
Timeline for d1hh9b2: